PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr006626.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 341aa    MW: 39635.6 Da    PI: 7.5837
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr006626.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.21.6e-12443141
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqck 41
                     rg W + Ede+l ++v+++G+++W++Ia++++ gR++k ++
      Pbr006626.1  4 RGHWRPAEDEKLRELVERYGPHNWNAIAEKLQ-GRSEKRVV 43
                     899*****************************.***99876 PP

2Myb_DNA-binding361.6e-111351691046
                      HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
      Pbr006626.1 135 ERLLVSHRIHGNR-WAVIARLFP-GRTDNAVKNHWHV 169
                      7888889******.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.08154IPR017930Myb domain
SMARTSM007178.9E-7352IPR001005SANT/Myb domain
SuperFamilySSF466893.3E-9343IPR009057Homeodomain-like
PfamPF002496.2E-12443IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-22538IPR009057Homeodomain-like
CDDcd001672.28E-9744No hitNo description
SuperFamilySSF466892.09E-126998IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-1580168IPR009057Homeodomain-like
PROSITE profilePS5129411.98995175IPR017930Myb domain
SMARTSM007170.0037125173IPR001005SANT/Myb domain
PfamPF002491.4E-8135168IPR001005SANT/Myb domain
CDDcd001671.64E-6135168No hitNo description
SuperFamilySSF466892.09E-12143171IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MCTRGHWRPA EDEKLRELVE RYGPHNWNAI AEKLQGRSEK RVVNGLGLVY STLEGKEGYH  60
LIERCFCNII TYMNNIYELN DAGKSCRLRW FNQLDPRINR NPFTEEEXXX XXXXXXXXXX  120
XXXXXXXXXX XXXXERLLVS HRIHGNRWAV IARLFPGRTD NAVKNHWHVI MARRCRERSR  180
LNHSKLIRNT STAQTSFMSI ITNNNEPKSS SKQDHPLQIN CDIGTWNLDS YNYIGKYYSC  240
SDRNYHQYRP AFTHSPPPPF PKEFYPNTCS ATMHQDHNKD QPIEFYDFLQ VNTESNGSEV  300
IDNARKEEEE VDQEGTGQQK SNVAGLPFID FLAVNTGISS *
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2295925e-42KP229592.1 UNVERIFIED: Boehmeria nivea MYB transcription factor-like (MYB36) mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009341782.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLA0A0H4CRL43e-97A0A0H4CRL4_BETPL; MYB transcription factor 3
STRINGPOPTR_0015s05130.11e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.14e-72myb domain protein 52